PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_F8DFD036F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 68aa    MW: 7875.87 Da    PI: 7.5213
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_F8DFD036F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.56.9e-142521161
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                            +NR++A+  R+RKka++  Le kvk Le++N++L ++ ++l++e + l++
  Traes_6DS_F8DFD036F.2  2 LRNRVSAQQARERKKAYLGDLEVKVKDLEKKNSELEERHSTLQNENQMLRQ 52
                           69********************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147042.43E-13148No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-16155No hitNo description
PROSITE profilePS5021710.3152IPR004827Basic-leucine zipper domain
PfamPF001707.2E-12252IPR004827Basic-leucine zipper domain
SMARTSM003385.4E-6256IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-13254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
LLRNRVSAQQ ARERKKAYLG DLEVKVKDLE KKNSELEERH STLQNENQML RQCLSVSPID  60
LDHSSEGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3576801e-81AK357680.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1059E13.
GenBankAK3655261e-81AK365526.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034M24.
GenBankAK3758151e-81AK375815.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3106C21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571497.11e-30PREDICTED: transcription factor HY5-like
SwissprotO246466e-24HY5_ARATH; Transcription factor HY5
TrEMBLW5H5N13e-42W5H5N1_WHEAT; Uncharacterized protein
STRINGBRADI3G07540.14e-30(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.13e-25bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]